PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn323021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 429aa    MW: 47369.5 Da    PI: 7.5809
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn323021genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94.1e-32255308255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Achn323021 255 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 308
                 9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-15252308IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-28253308IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23255308IPR006447Myb domain, plants
PfamPF002497.7E-7256307IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MPLEGIFIEP SSNPSPDLSL HISPPNTSSI CNNIGLEHSS FNLSGRHSDS QKARASTNSL  60
TDLSLAHPAN VVTDSGGHPQ NFSHEPLLRN PNHHYVHHHN NPSHWNHINH GVSLLDVSSD  120
GLRPIKGIPV YHNRSFPFMP MNQVRDHRDY NPKMPFYQMP YPSLSSPSSS SSSSLLSHSL  180
SSPFLDPMSI LNSGPNGSSS SPYRTFPPRL NGLSPSYQLH HHHNYGVGPS NEASHGLIRS  240
RFMPKLPSKR SMRAPRMRWT STLHARFVHA VELLGGHERA TPKSVLELMD VKDLTLAHVK  300
SHLQMYRTVK TTDKPAASSG QSDGSGEEDI STMGQRGPSD GSLPQETDFP STTTLWSNSS  360
SSREAWLQTN SIDMDRLRAS TLPSQQRFGH QLEESGLNHM TGYLGSDLDQ KNPSLEFTLG  420
RPDWQTTD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002266463.11e-166PREDICTED: transcription repressor KAN1 isoform X1
TrEMBLF6HI081e-164F6HI08_VITVI; Putative uncharacterized protein
TrEMBLC5DB441e-164C5DB44_VITVI; KANADI like transcription factor
STRINGVIT_04s0043g00340.t011e-163(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24682355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.14e-64G2-like family protein